LL-37
Cathelicidin fragment, 37 amino acids
LL-37 is a 37 amino acid peptide, the active fragment of human cathelicidin. It is studied in antimicrobial and immune research models.
Supplied lyophilised in a sterile glass vial with a published batch certificate.

Research use only. Not for human or veterinary use. We cannot provide guidance relating to human consumption, including dosage, protocols or administration, under any circumstances. MYOGENX operates strictly as a research supplier.
Price on enquiry
In UK stock
Either option opens a message already filled in with the product, strength and quantity above, addressed to [email protected] or 07907 747415. Check it, then send. MYOGENX replies to quote a price and take payment. Nothing on this site is bought through a basket.
- SKU
- MGX-LL37-10
- Batch
- MGX-2406-LL37
- Dispatch
- Same day before 15:00, Mon to Fri
- Shipping
- Free UK shipping
Batch verified
MGX-2406-LL37
Analysed by Pace Lab. Published before this batch went on sale, and printed on the vial.
Read the certificateSpecification
The full record
Everything on the certificate, on the page. Nothing held back for after you have paid.
| Purity | 98.9% by HPLC |
|---|---|
| CAS number | 154947-66-7 |
| Molecular weight | 4493.33 g/mol |
| Format | Lyophilised powder in a sterile glass vial |
| Appearance | White lyophilised solid |
| Storage | -20°C in a dry, dark, desiccated environment |
| Sequence | [LL-37, 37 aa] |
| Intended use | Laboratory research only. Not for human or veterinary use. |
Also in this category


